PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo18G0035000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 184aa    MW: 20971.8 Da    PI: 9.9711
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo18G0035000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd llv++++ +G g+W+  ar  g++Rt+k+c++rw++yl
  Spipo18G0035000 17 RGPWTLEEDSLLVHYITCHGEGRWNHLARSSGLKRTGKSCRLRWLNYL 64
                     89********************************************97 PP

2Myb_DNA-binding52.89.1e-1770113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE+ l++d++ ++G++ W++Ia+ ++ gRt++++k++w++
  Spipo18G0035000  70 RGNLTPEEQILILDLHSKWGNR-WSRIAQQLP-GRTDNEIKNYWRT 113
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4321264IPR017930Myb domain
SuperFamilySSF466891.72E-3014111IPR009057Homeodomain-like
SMARTSM007175.2E-131666IPR001005SANT/Myb domain
PfamPF002491.6E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-221871IPR009057Homeodomain-like
CDDcd001677.34E-101964No hitNo description
PROSITE profilePS5129424.97565119IPR017930Myb domain
SMARTSM007172.9E-1469117IPR001005SANT/Myb domain
PfamPF002493.5E-1570113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2472118IPR009057Homeodomain-like
CDDcd001676.26E-1174113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MSNKPALKFD EHVELRRGPW TLEEDSLLVH YITCHGEGRW NHLARSSGLK RTGKSCRLRW  60
LNYLKPDVKR GNLTPEEQIL ILDLHSKWGN RWSRIAQQLP GRTDNEIKNY WRTRVQKQAR  120
QLNVDANSAV FRNALPCFCT TAVNPAPALG SAAPYGGGDN AVGDGVWSID ELWEFRKQHK  180
WGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-261411924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009390937.17e-79PREDICTED: myb-related protein 305-like
SwissprotP813912e-63MYB05_ANTMA; Myb-related protein 305
TrEMBLM0SGH24e-78M0SGH2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P21060_0011e-77(Musa acuminata)
STRINGOB01G11750.11e-76(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-71myb domain protein 62